alpha1- Antitrypsin (Native Protein)

alpha1- Antitrypsin (Native Protein) is available 0 time from Biotez labs

  • Protein type
    Native
  • Protein subtype
    N/A
  • Protein family
    Inhibitor of serine proteases, Member of Serpin Family
  • Protein description
    SERPIN1's primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE).
  • Research area interests
    Diseases associated with SERPINA1 include Emphysema Due To Aat Deficiency and Hemorrhagic Disease Due To Alpha-1-Antitrypsin Pittsburgh Mutation. Among its related pathways are Platelet activation, signaling and aggregation and FOXA1 transcription factor network.
  • Package form
    liquid
  • Tested applications
    inhibitor of proteases
  • Other names
    Serpin Family A Member 1, Serpin Peptidase Inhibitor, Clade A,
  • Peptide sequence
    MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
  • Available target modification
    No
  • Expression system
    Human Blood
  • Product Subtype
    full length
  • Active form?
    Yes
  • Tag
    untagged
  • Contents
    50mM phosphate buffer pH 6.5; 100mM NaCl, without BSA and Azide
  • Protein purity
    >95%
  • Molecular weight
    54 kDa
  • UniProt number
    P01009
  • Gene number
    5265
  • Abbreviation
    SERPINA1
  • Full name
    serpin family A member 1
  • Other desciption
    Purified from human serum.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    cool packs or dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Gene target
  • Short name
    alpha1- Antitrypsin (Native Protein)
  • Alternative name
    alpha1- Antitrypsin (Native Protein)
  • Alternative technique
    antibodies
Simillar products
Supplier:MyBioSource
Price:409.21USD
Supplier:CDH INTL
Price:345.71USD
Supplier:BT-Laboratory
Price:415.09USD
Supplier:Ape
Price:277.63USD
Supplier:ABM microrna
Price:1 531.02USD
Supplier:abm Adinovirus
Price:774.92USD
Supplier:Biomatik
Price:433.91USD
Supplier:abm Adinovirus
Price:506.81USD
Supplier:MBS Recombinant
Price:1 520.44USD
Supplier:genways
Price:612.64USD
Supplier:ABM microrna
Price:2 558.76USD
Supplier:MyBioSource
Price:435.08USD
Supplier:abm Adinovirus
Price:774.92USD
Supplier:ABM lentivectors
Price:1 322.89USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:Cusabio
Price:176.39USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
alpha1- Antitrypsin (Native Protein) - Gentaur.com
Contact
Chat with gentaur.com employee