-
Target antigen
Alpha Defensin 1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Alpha Defensin 1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Alpha Defensin 1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.
-
Related articles
1. "Entrez Gene: DEFA1 defensin, alpha 1". 2. Aldred PM, Hollox EJ, Armour JA (Jul 2005). "Copy number polymorphism and expression level variation of the human alpha-defensin genes DEFA1 and DEFA3".Hum Mol Genet. 14 (14): 2045–52. 3. Feng Y, Gutekunst CA, Eberhart DE, Yi H, Warren ST, Hersch SM (Mar 1997). "Fragile X mental retardation protein: nucleocytoplasmic shuttling and association with somatodendritic ribosomes". J Neurosci. 17 (5): 1539–47.
-
Gene Name
DEFA1
-
Protein Name
Neutrophil defensin 1
-
Gene Full Name
defensin alpha 1
-
Synonyms
DEF1 | DEFA1 | DEFA1B | DEFA2 | Defensin 1 | Defensin | HNP-1 | HNP-2 | HNP1 | HP-1 | HP-2 | HP1 | HP2 | MRS | P59665
-
Uniprot ID
P59665
-
Entrez GeneID
1667
-
Description
The Alpha Defensin 1 Antibody is a α- or alpha protein sometimes glycoprotein present in blood. human, mouse or other beta β- and alpha α- defensins are expressed by neutrophils ( α- ), lymphocytes and epithelial cells. DEFA DEFB genes defend the host against pathogens. GENTAUR supplies anti-defensins, monclonals, polyclonals antisera and recombinant DEFs or peptides of defensin.
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
