ACADVL Antibody / VLCAD
-
Catalog numberR32491
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenACADVL / VLCAD
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.5-1ug/ml
-
Added bufferLyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
-
Intented useThis ACADVL antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP49748
-
PurityAntigen affinity
-
DescriptionVery long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
-
ImmunogenAmino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.
-
StorageAfter reconstitution, the ACADVL antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolACADVL
-
Short nameAnti- ACADVL / VLCAD
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to ACADVL / VLCAD
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameacyl-CoA dehydrogenase very long chain
-
Synonyms gene name
- acyl-Coenzyme A dehydrogenase, very long chain
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1996-05-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Acyl-CoA dehydrogenase family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data