ABCD4 Blocking Peptide

Product Type

Proteins
Product Subtype

Blocking Peptides
Research Area

Cell Biology
Tag Conjugate

FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
Type1

Synthetic
Form Buffer

Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage

Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications

WB, IHC
Shipping Info

Blue Ice
Test

You can block the antibody by the specific target amino acid sequence of peptide.
Properties

blocking peptide
Description

Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

Gene target

ABCD4
Gene symbol

ABCD4
Short name

ABCD4 Blocking Peptide
Technique

blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
Alternative name

adenosine triphosphate-binding cassette, sub-family D (ALD), member 4 inhibiting short protein sequence
Alternative technique

control, peptides
Alternative to gene target

ATP-binding cassette, sub-family D (ALD), member 4, ABC41 and EST352188 and MAHCJ and P70R and P79R and PMP69 and PXMP1L, ABCD4 and IDBG-11957 and ENSG00000119688 and 5826, ATPase activity, Plasma membranes, Abcd4 and IDBG-156897 and ENSMUSG00000021240 and 19300, ABCD4 and IDBG-646851 and ENSBTAG00000014633 and 528646