Recombinant Mouse Growth Hormone/GH

• Catalog number
  C048-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Mouse Growth Hormone is produced by our E.coli expression system and the target gene encoding Phe27-Phe216 is expressed.
• Species reactivity
  Mouse
• Origin
  Escherichia coli
• Peptide sequence
  MFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
• Estimated molecular weight
  21,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl, 500mM NaCl, pH 8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P06880
• Other related products
• Additional description
  Hormone releasing factors and releasing hormones are  signaling molecules produced by glands in multicellular organisms. The glands that secrete Luteinizing hormones LHRG and LH, FSH comprise the endocrine signaling system. The term growth hormone releasing hormone GHRH is sometimes extended to include chemicals produced by cells that affect the same cell (autocrine or intracrine signaling) or nearby cells (paracrine signaling). Human recombinant LHRG and GHRH are produced in E. coli or in yeast cells.
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Growth   Hormone/GH  
• Gene symbol
  GH1, GH2
• Short name
  Recombinant Mouse Growth Hormone/GH
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse Growth Hormone/GH
• Alternative technique
  rec, murine

Gene info

• Identity
  HGNC:4261
• Gene
  GH1
• Long gene name
  growth hormone 1
• Synonyms
  • GH-N
  • GHN
  • GH
  • hGH-N
• Synonyms name
  • pituitary growth hormone
  • somatotropin
• GenBank acession
  • M13438
• Locus
  17q23.3
• Discovery year
  2001-06-22
• Entrez gene record
  2688
• Pubmed identfication
  • 6306568
• RefSeq identity
  • NM_000515
• Classification
  • Growth hormone family
• VEGA ID
  OTTHUMG00000172293

Gene info

• Identity
  HGNC:4262
• Gene
  GH2
• Long gene name
  growth hormone 2
• Synonyms
  • GH-V
  • GHV
  • GHL
  • hGH-V
• Synonyms name
  • placental-specific growth hormone
  • placenta-specific growth hormone
• GenBank acession
  • J03756
• Locus
  17q23.3
• Discovery year
  2001-06-22
• Entrez gene record
  2689
• Pubmed identfication
  • 6306568
• RefSeq identity
  • NM_002059
• Classification
  • Growth hormone family
• VEGA ID
  OTTHUMG00000172284

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products