Recombinant Human E3 Ubiquitin-Protein Ligase CHIP/CHIP
-
Catalog number
C115-500
-
Price
Please ask
-
Size
500 ug
-
-
Description
Recombinant Human STUB1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr303 is expressed.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
-
Estimated molecular weight
34,86 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Dry ice/ice packs
-
Package form
Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
-
Storage conditions
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
Q9UNE7
-
-
Properties
Precipitation of Chromatins is a pull down technique of native DNA sequences by specific binding proteins on which on the other side of the protein the antibody can bind. Lots of antibodies are not suited for Chip analysis pulldown because they bind on the binding site of the DNA. The novo antibody is proven to not bind on the DNA binding site and is suitable for ChiP precipitation supplied in 1 vials. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
ITCH, HECTD3, PRKN
-
Short name
Recombinant E3 Ubiquitin-Protein Ligase CHIP/CHIP
-
Technique
Recombinant, ChiP, Chromatine immuno Precipitationg antibody, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human STUB1/CHIP
-
Alternative technique
rec, epigenetics
-
Gene info
Gene info
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
A DNA amplification technique based upon the ligation of OLIGONUCLEOTIDE PROBES. The probes are designed to exactly match two adjacent sequences of a specific target DNA. The chain reaction is repeated in three steps in the presence of excess probe: (1) heat denaturation of double-stranded DNA, (2) annealing of probes to target DNA, and (3) joining of the probes by thermostable DNA ligase. After the reaction is repeated for 20-30 cycles the production of ligated probe is measured.
-
Tree numbers
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products