Leptin Antibody / LEP

• Catalog number
  R32090
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  Leptin / LEP
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Mouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, ELISA
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,ELISA : 0.1-0.5ug/ml
• Notes
  Optimal dilution of the Leptin antibody should be determined by the researcher.
• Intented use
  This Leptin antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P41160
• Purity
  Antigen affinity
• Description
  Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.
• Immunogen
  Amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody.
• Storage
  After reconstitution, the Leptin antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Gene
  Human or mouse Leptin (from Greek λεπτός leptos, "thin") the "satiety hormone", is a hormone made by adipose cells that helps to regulate energy balance by inhibiting hunger. Leptin is opposed by the actions of the hormone ghrelin, the "hunger hormone". Both hormones act on receptors in the arcuate nucleus of the hypothalamus to regulate appetite to achieve energy homeostasis. ELISA kits and peptides and antibodies are available.
• French translation
  anticorps

• Gene target
  Leptin   LEP  
• Gene symbol
  LEP
• Short name
  Anti-Leptin / LEP
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to Leptin / LEP
• Alternative technique
  antibodies
• Alternative to gene target
  leptin, LEPD and OB and OBS, LEP and IDBG-39587 and ENSG00000174697 and 3952, peptide hormone receptor binding, Extracellular, Lep and IDBG-130781 and ENSMUSG00000059201 and 16846, OBESE and IDBG-635003 and ENSBTAG00000014911 and 280836

Gene info

• Identity
  HGNC:6553
• Gene
  LEP
• Long gene name
  leptin
• Synonyms gene
  • OBS
  • OB
• Synonyms gene name
  • leptin (murine obesity homolog)
  • leptin (obesity homolog, mouse)
• Locus
  7q32.1
• Discovery year
  1993-01-26
• Entrez gene record
  3952
• Pubmed identfication
  • 1686014
  • 16932309
• Classification
  • Neuropeptides
• VEGA ID
  OTTHUMG00000157564

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products