GRK5 Antibody
-
Catalog numberR32073
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenGRK5
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the GRK5 antibody should be determined by the researcher.
-
Intented useThis GRK5 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP34947
-
PurityAntigen affinity
-
DescriptionG protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
-
ImmunogenAmino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.
-
StorageAfter reconstitution, the GRK5 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationNuclear, cytoplasmic
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolGRK5, GRK5-IT1
-
Short nameAnti-GRK5
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to GRK5
-
Alternative techniqueantibodies
-
Alternative to gene targetG protein-coupled receptor kinase 5, GPRK5, GRK5 and IDBG-91131 and ENSG00000198873 and 2869, transferase activity, nuclei, Grk5 and IDBG-181926 and ENSMUSG00000003228 and 14773, GRK5 and IDBG-640359 and ENSBTAG00000007981 and 281801
-
Gene info
-
Identity
-
Gene
-
Long gene nameG protein-coupled receptor kinase 5
-
Synonyms gene
-
GenBank acession
-
Locus
-
Discovery year1994-03-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- AGC family kinases
- MicroRNA protein coding host genes
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameGRK5 intronic transcript 1
-
Synonyms gene name
- GRK5 intronic transcript 1 (non-protein coding)
-
Locus
-
Discovery year2013-12-20
-
Entrez gene record
-
RefSeq identity
-
Classification
- Intronic transcripts
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data