AQP1 Antibody / Aquaporin 1

  • Catalog number
    R32050
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    AQP1 / Aquaporin 1
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
  • Notes
    Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher.
  • Intented use
    This Aquaporin 1 antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P29972
  • Purity
    Antigen affinity
  • Description
    Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
  • Immunogen
    Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody.
  • Storage
    After reconstitution, the Aquaporin 1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Membrane
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    AQP1   Aquaporin  
  • Gene symbol
    AQP1
  • Short name
    Anti-AQP1 / Aquaporin 1
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to AQP1 / Aquaporin 1
  • Alternative technique
    antibodies
  • Alternative to gene target
    Uncharacterized protein, AQP1 and IDBG-407682 and ENSG00000250424 and, transporter activity, Plasma membranes
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee