AIFM1 Antibody

  • Catalog number
    R31851
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    AIFM1
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P, ICC
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml,ICC: 0.5-1ug/ml
  • Notes
    Optimal dilution of the AIF antibody should be determined by the researcher.
  • Intented use
    This AIF antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    O95831
  • Purity
    Antigen affinity
  • Description
    Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.
  • Immunogen
    Amino acids FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED of human AIF were used as the immunogen for the AIF antibody.
  • Storage
    After reconstitution, the AIF antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Cytoplasmic
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    AIFM1  
  • Gene symbol
    AIFM1
  • Short name
    Anti-AIFM1
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to AIFM1
  • Alternative technique
    antibodies
  • Alternative to gene target
    apoptosis-inducing factor, mitochondrion-associated, 1, AIF and CMT2D and CMTX4 and COWCK and COXPD6 and NADMR and NAMSD and PDCD8, AIFM1 and IDBG-85972 and ENSG00000156709 and 9131, oxidoreductase activity, nuclei, Aifm1 and IDBG-143630 and ENSMUSG00000036932 and 26926, AIFM1 and IDBG-630636 and ENSBTAG00000006838 and 535714
Gene info
  • Identity
  • Gene
  • Long gene name
    apoptosis inducing factor mitochondria associated 1
  • Synonyms gene
  • Synonyms gene name
    • programmed cell death 8 (apoptosis-inducing factor)
    • neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome)
    • apoptosis-inducing factor, mitochondrion-associated, 1
    • apoptosis inducing factor, mitochondria associated 1
    • auditory neuropathy, X-linked recessive 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1999-05-28
  • Entrez gene record
  • Pubmed identfication
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee