ADRA1A Antibody

  • Catalog number
    R32076
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    ADRA1A
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the ADRA1A antibody should be determined by the researcher.
  • Intented use
    This ADRA1A antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P35348
  • Purity
    Antigen affinity
  • Description
    ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
  • Immunogen
    Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.
  • Storage
    After reconstitution, the ADRA1A antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    ADRA1A  
  • Gene symbol
    ADRA1A, ADRA1D
  • Short name
    Anti-ADRA1A
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to ADRA1A
  • Alternative technique
    antibodies
  • Alternative to gene target
    adrenoceptor alpha 1A, ADRA1C and ADRA1L1 and ALPHA1AAR, ADRA1A and IDBG-13362 and ENSG00000120907 and 148, protein heterodimerization activity, nuclei, Adra1a and IDBG-175481 and ENSMUSG00000045875 and 11549, ADRA1A and IDBG-635639 and ENSBTAG00000031632 and 282134
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee