ADRA1A Antibody
-
Catalog numberR32076
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenADRA1A
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the ADRA1A antibody should be determined by the researcher.
-
Intented useThis ADRA1A antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP35348
-
PurityAntigen affinity
-
DescriptionADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
-
ImmunogenAmino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.
-
StorageAfter reconstitution, the ADRA1A antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolADRA1A, ADRA1D
-
Short nameAnti-ADRA1A
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to ADRA1A
-
Alternative techniqueantibodies
-
Alternative to gene targetadrenoceptor alpha 1A, ADRA1C and ADRA1L1 and ALPHA1AAR, ADRA1A and IDBG-13362 and ENSG00000120907 and 148, protein heterodimerization activity, nuclei, Adra1a and IDBG-175481 and ENSMUSG00000045875 and 11549, ADRA1A and IDBG-635639 and ENSBTAG00000031632 and 282134
-
Gene info
-
Identity
-
Gene
-
Long gene nameadrenoceptor alpha 1A
-
Synonyms gene
-
Synonyms gene name
- adrenergic, alpha-1A-, receptor
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1991-08-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Adrenoceptors
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameadrenoceptor alpha 1D
-
Synonyms gene name
- adrenergic, alpha-1D-, receptor
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1990-09-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Adrenoceptors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data