Native Human Serum Aminopeptidase N (ANPEP) (Native Protein)

  • Catalog number
    30 801 003
  • Price
    Please ask
  • Size
    200 µg/ 1 ml
  • Protein type
    Native
  • Protein subtype
    EC 3.4.11.2
  • Protein family
    Aminopeptidase
  • Protein description
    ANPEP plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection.
  • Research area interests
    Diseases associated with ANPEP include Tetrasomy 21 and Acute Leukemia. Among its related pathways are Hematopoietic cell lineage and Transport to the Golgi and subsequent modification
  • Package form
    liquid
  • Tested applications
    Screening of inhibitors; Characterization of structure and function; Target for angiogenesis
  • Other names
    ANPEP; Myeloid Plasma Membrane Glycoprotein CD13, Membrane Alanyl Aminopeptidase
  • Peptide sequence
    MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK
  • Available target modification
    Yes
  • Expression system
    Human Serum
  • Product Subtype
    full length
  • Active form
    Yes
  • Tag
    untagged
  • Contents
    20 mM Tris-HCl, pH 7.4, 500 mM NaCl, 1mM CaCl2
  • Protein purity
    >90%
  • Molecular weight
    110-130 kDa
  • UniProt number
    P15144
  • Gene number
    290
  • Abbreviation
    ANPEP
  • Full name
    alanyl aminopeptidase, membrane
  • Other desciption
    Aminopeptidase N is prepared from human serum certified to be negative for HBsAg and for antibodies to HIV and HCV.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Description
    Azide Free Serum for cell culture FBS fetal bovine serum. Filtered serum for sterility. The polyclonal serum contains no red or white blood cells or clotting factors; it is the blood plasma not including the fibrinogens. Serum includes all proteins and antibodies not used in blood clotting (coagulation) and all the electrolytes, antibodies, antigens, hormones, and any exogenous substances like drugs and microorganisms. Plasmas on request.
  • Group
    Sera
  • About
    Serum should be stored at +5°C
  • Gene target
  • Gene symbol
    ANPEP
  • Short name
    Native Serum Aminopeptidase N (ANPEP) (Native Protein)
  • Technique
    serum
  • Species
    Homo sapiens, Humans
  • Alternative name
    Native H. sapiens blood serum Aminopeptidase N (ANPEP) (Native Protein)
  • Alternative technique
    sera
  • Tissue
    serum
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee