Min length of search pharse is two chars

Filters

Recombinant Rat Complement factor D (Cfd)

  • Catalog number
    RPC20599
  • Product name
    Recombinant Rat Complement factor D (Cfd)
  • Size
    20 μg
  • Price
    703.00 EUR
  • Supplier
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    P32038
  • Gene number
    Cfd
  • Other name
    Adipsin; C3 convertase activator; Endogenous vascular elastase; Properdin factor D
  • Protein origin
    Mammalian cell
  • Protein region
    26-263aa
  • Protein sequence
    ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    31.31kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Complement factor D (Cfd)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    recombinant Rat Complement factor D (complement factor D (adipsin))
  • Alternative technique
    rec
  • Alternative to gene target
    complement factor D (adipsin), ADIPSIN and ADN and DF and PFD, CFD and IDBG-13129 and ENSG00000197766 and 1675, this GO :0002576 and platelet degranulation and biological process this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006508 and proteolysis and biological process this GO :0006956 and complement activation and biological process this GO :0006957 and complement activation, alternative pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0008236 and serine-type peptidase activity and molecular function this GO :0030168 and platelet activation and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, serine-type peptidase activity, this GO :0003824: catalytic activity and also this GO :0004252: serine-type endopeptidase activity and also this GO :0008236: serine-type peptidase activity, this GO :0003824: catalytic activity, this GO :0004252: serine-type endopeptidase activity, this GO :0008236: serine-type peptidase activity, Extracellular, Cfd and IDBG-171424 and ENSMUSG00000061780 and 11537
MESH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Related products
Chat with gentaur.com employee