Min length of search pharse is two chars

Filters

Recombinant Human Thymic stromal lymphopoietin(TSLP)

  • Catalog number
    RPC20590
  • Product name
    Recombinant Human Thymic stromal lymphopoietin(TSLP)
  • Size
    20 μg
  • Price
    666.74
  • Supplier
    bioma
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q969D9
  • Gene number
    TSLP
  • Other name
    no alternative name
  • Protein origin
    Mammalian cell
  • Protein region
    29-159aa
  • Protein sequence
    YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
  • Information about sequence
    Full Length
  • Expected molecular weight
    18.51kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Thymic stromal lymphopoietin(TSLP)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    recombinant H. sapiens Thymic stromal lymphopoietin(thymic stromal lymphopoietin)
  • Alternative technique
    rec
  • Alternative to gene target
    thymic stromal lymphopoietin, TSLP and IDBG-36507 and ENSG00000145777 and 85480, this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component, cytokine activity, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity, Extracellular, Tslp and IDBG-134008 and ENSMUSG00000024379 and 53603
1. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Related products
Chat with gentaur.com employee