Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag)

  • Catalog number
    CS55-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Human NKG2A & CD94 Heterodimer is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 & Ser34-Ile179 is expressedwith a 8His & Flag tag at the N-terminus
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL&DYKDDDDKSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
  • Estimated molecular weight
    34,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P26715&Q13241
  • Properties
    An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, or FLAG octapeptide, or FLAG epitope that is a polypeptide protein tag that can be added to a protein using recombinant DNA. This FLAG-tags have the sequence DYKDDDDK motiv.  These tags are very useful to do protein purification by affinity chromatography. Also separation of recombinant, overexpressed proteins from cell lysates is done by FLAG go HIS tags. FLAGS are also used in the isolation of protein complexes with multiple subunits, because its mild purification procedure tends not to disrupt such complexes. It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray. Suitable for in vivo use in cells. For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Conjugation
    Flag
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    KLRD1
  • Short name
    Recombinant NKG2A & CD94 Heterodimer (N-8His & N- )
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    Flag
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag)
  • Alternative technique
    rec
Gene info
  • Identity
  • Gene
  • Long gene name
    killer cell lectin like receptor D1
  • Synonyms gene
  • Synonyms gene name
    • killer cell lectin-like receptor subfamily D, member 1
  • GenBank acession
  • Locus
  • Discovery year
    1998-01-16
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Killer cell lectin like receptors
    • C-type lectin domain containing
    • CD molecules
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee