Min length of search pharse is two chars

Filters
US: (408) 780-0908 | EU: 0032 16 58 90 45 lieven@gentaur.com

Recombinant Human Leukemia Inhibitory Factor/LIF

  • Catalog number
    C017-500
  • Product name
    Recombinant Human Leukemia Inhibitory Factor/LIF
  • Size
    500 ug
  • Price
    1674EUR
  • Supplier
    novo
  • Ask
  • Description
    Recombinant Human Leukemia Inhibitory Factor is produced by our E.coli expression system and the target gene encoding Ser23-Phe202 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
  • Estimated molecular weight
    19,7 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 0.02% Tween 20, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P15018
  • Additional description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Leukemia Inhibitory Factor/LIF
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    recombinant H. sapiens Leukemia Inhibitory Factor/leukemia inhibitory factor
  • Alternative technique
    rec
  • Alternative to gene target
    leukemia inhibitory factor, CDF and DIA and HILDA and MLPLI, LIF and IDBG-3968 and ENSG00000128342 and 3976, this GO :0001135 and RNA polymerase II transcription factor recruiting transcription factor activity and molecular function this GO :0001974 and blood vessel remodeling and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007566 and embryo implantation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0030324 and lung development and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046697 and decidualization and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0048711 and positive regulation of astrocyte differentiation and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0048863 and stem cell differentiation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060426 and lung vasculature development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060707 and trophoblast giant cell differentiation and biological process this GO :0060708 and spongiotrophoblast differentiation and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0072307 and regulation of metanephric nephron tubule epithelial cell differentiation and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901676 and positive regulation of histone H3-K27 acetylation and biological process, growth factor activity, this GO :0001135: RNA polymerase II transcription factor recruiting transcription factor activity and also this GO :0005102: receptor binding and also this GO :0005125: cytokine activity and also this GO :0005146: leukemia inhibitory factor receptor binding and also this GO :0008083: growth factor activity, this GO :0001135: RNA polymerase II transcription factor recruiting transcription factor activity, this GO :0005102: receptor binding, this GO :0005125: cytokine activity, this GO :0005146: leukemia inhibitory factor receptor binding, this GO :0008083: growth factor activity, Extracellular, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840
  • Ask
1. Gene info
MESH Data
  • Name
  • Concept
    Scope note: Leukemia induced experimentally in animals by exposure to leukemogenic agents, such as VIRUSES; RADIATION; or by TRANSPLANTATION of leukemic tissues.
  • Tree numbers
    • C04.557.337.372
    • C04.619.531
    • E05.598.500.496.500
  • Qualifiers
    parasitology, immunology, microbiology, diagnosis, diagnostic imaging, physiopathology, rehabilitation, enzymology, etiology, mortality, epidemiology, prevention & control, blood, cerebrospinal fluid, chemically induced, congenital, diet therapy, drug therapy, therapy, psychology, urine, virology, history, classification, complications, economics, embryology, genetics, metabolism, nursing, radiotherapy, surgery, ethnology, pathology
Related products
Chat with gentaur.com employee