Min length of search pharse is two chars

Filters
US: (408) 780-0908 | EU: 0032 16 58 90 45 lieven@gentaur.com

Recombinant Human Erythropoietin/EPO (C-6His)

  • Catalog number
    C001-500
  • Product name
    Recombinant Human Erythropoietin/EPO (C-6His)
  • Size
    500 ug
  • Price
    812EUR
  • Supplier
    novo
  • Ask
  • Description
    Recombinant Human Erythropoietin is produced by our Mammalian expression system and the target gene encoding Ala28-Arg193 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRHHHHHH
  • Estimated molecular weight
    19,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P01588
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Erythropoietin/EPO (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    recombinant H. sapiens Erythropoietin/erythropoietin (C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    erythropoietin, EP and MVCD2, EPO and IDBG-31941 and ENSG00000130427 and 2056, this GO :0001666 and response to hypoxia and biological process this GO :0005128 and erythropoietin receptor binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007584 and response to nutrient and biological process this GO :0008015 and blood circulation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009651 and response to salt stress and biological process this GO :0009986 and cell surface and cellular component this GO :0010523 and negative regulation of calcium ion transport into cytosol and biological process this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0030218 and erythrocyte differentiation and biological process this GO :0030295 and protein kinase activator activity and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033033 and negative regulation of myeloid cell apoptotic process and biological process this GO :0033189 and response to vitamin A and biological process this GO :0033574 and response to testosterone and biological process this GO :0042523 and positive regulation of tyrosine phosphorylation of Stat5 protein and biological process this GO :0042541 and hemoglobin biosynthetic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043249 and erythrocyte maturation and biological process this GO :0043627 and response to estrogen and biological process this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048678 and response to axon injury and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0061418 and regulation of transcription from RNA polymerase II promoter in response to hypoxia and biological process this GO :0070555 and response to interleukin-1 and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0071474 and cellular hyperosmotic response and biological process this GO :1902219 and negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress and biological process this GO :1902251 and negative regulation of erythrocyte apoptotic process and biological process this GO :2001258 and negative regulation of cation channel activity and biological process, protein kinase activator activity, this GO :0005128: erythropoietin receptor binding and also this GO :0005179: hormone activity and also this GO :0005515: protein binding and also this GO :0030295: protein kinase activator activity, this GO :0005128: erythropoietin receptor binding, this GO :0005179: hormone activity, this GO :0005515: protein binding, this GO :0030295: protein kinase activator activity, Extracellular, Epo and IDBG-205003 and ENSMUSG00000029711 and 13856, EPO and IDBG-640493 and ENSBTAG00000003430 and 280784
  • Ask
1. Gene info
MESH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Related products
Chat with gentaur.com employee