Recombinant Aequorea victoria Green fluorescent protein(GFP)

  • Catalog number
    RPC20120
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Aequorea victoria (Jellyfish)
  • Protein number
    P42212 
  • Gene number
    GFP
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    1-238aa
  • Protein sequence
    MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
  • Information about sequence
    Full Length
  • Expected molecular weight
    42.87kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Fluorescent microspheres, beads and particles applications including blood flow determination, tracing, fluorimetry, in vivo imaging and calibration of imaging and flow cytometry instruments. Because our fluorescent dyes are incorporated in the bead and not just on the surface, they are relatively immune to photo bleaching and other environmental factors. Spheres are in difference sizes and fluorescences, high intensity, FITC, GFP, red, green, yellow, light yellow, sky blue, blue, orange, deep-red, Nile-red, purple, mcherry. The diameter of the spheres is usually higher than 50nm and in the micrometer um range.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Aequorea victoria protein(GFP)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Alternative name
    Rec. Aequorea victoria Green fluorescent protein(Green Fluorescent)
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note: Radioimmunoassay of proteins using antibody coupled to an immunosorbent.
  • Tree numbers
    • E05.478.566.380.830
    • E05.478.566.639.830
    • E05.601.470.380.830
    • E05.601.470.639.830
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee