Procathepsin K (CTSK) (Recombinant Protein)

• Catalog number
  30 701 003
• Price
  Please ask
• Size
  200 µg/ 1 ml

• Protein type
  Recombinant
• Protein subtype
  EC 3.4.22
• Protein family
  Member of the peptidase C1 protein family
• Protein description
  CTSK is closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
• Research area interests
  Diseases associated with CTSK include Pycnodysostosis and Hyperostosis, Endosteal. Among its related pathways are Toll-like receptor signaling pathway and RANK Signaling in Osteoclasts.
• Package form
  liquid
• Tested applications
  Characterization of structure and function; Screening of inhibitors; Standard in enzymatic and immunologiacal assays; Drug target by excessive bone resorption, such as osteoporosis
• Other names
  CTSK
• Peptide sequence
  MEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
• Available target modification
  No
• Expression system
  E.coli
• Product Subtype
  protein fragment
• Active form
  Yes, after activation (pH adjusting)
• Tag
  untagged
• Contents
  500 mM NaCl, 25 mM Tris-HCl, pH 8.0
• Protein purity
  >95%
• Molecular weight
  24 kDa
• UniProt number
  P43235
• Gene number
  1513
• Abbreviation
  CTSK
• Full name
  cathepsin K
• Other desciption
  Recombinant human procathepsin K of amino acids Glu19 - Met215 is expressed in E. coli with an additional M-residue at the N-terminus.
• Purification
  Mentioned in the data sheet
• PubMed citations
  See the data sheet
• Warnings
  For Research Use only.
• Shipping conditions
  dry ice
• Storage condition
  Store at -70°C
• Technical datasheet
  Contact us to receive the datasheet
• Representative figure
• Other products
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Procathepsin   CTSK   Protein  
• Gene symbol
  CTSK
• Short name
  Procathepsin K (CTSK) (Recombinant Protein)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Homo sapiens
• Alternative name
  Procathepsin K (cathepsin K) (Rec. Protein)
• Alternative technique
  rec
• Alternative to gene target
  cathepsin K, CTS02 and CTSO and CTSO1 and CTSO2 and PKND and PYCD, CTSK and IDBG-102192 and ENSG00000143387 and 1513, proteoglycan binding, Extracellular, Ctsk and IDBG-172787 and ENSMUSG00000028111 and 13038, CTSK and IDBG-633328 and ENSBTAG00000021035 and 513038

Gene info

• Identity
  HGNC:2536
• Gene
  CTSK
• Long gene name
  cathepsin K
• Synonyms gene
  • CTSO2
  • CTSO
  • PYCD
• Synonyms gene name
  • cathepsin K (pycnodysostosis)
• Synonyms
  • PKND
• GenBank acession
  • BC016058
• Locus
  1q21.3
• Discovery year
  1995-05-11
• Entrez gene record
  1513
• Pubmed identfication
  • 7818555
• RefSeq identity
  • NM_000396
• Classification
  • Cathepsins
• VEGA ID
  OTTHUMG00000035008

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products