Procathepsin K (CTSK) (Recombinant Protein)

  • Catalog number
    30 701 002
  • Price
    Please ask
  • Size
    10 µg/ 50 µl
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.22
  • Protein family
    Member of the peptidase C1 protein family
  • Protein description
    CTSK is closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
  • Research area interests
    Diseases associated with CTSK include Pycnodysostosis and Hyperostosis, Endosteal. Among its related pathways are Toll-like receptor signaling pathway and RANK Signaling in Osteoclasts.
  • Package form
    liquid
  • Tested applications
    Characterization of structure and function; Screening of inhibitors; Standard in enzymatic and immunologiacal assays; Drug target by excessive bone resorption, such as osteoporosis
  • Other names
    CTSK
  • Peptide sequence
    MEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
  • Available target modification
    No
  • Expression system
    E.coli
  • Product Subtype
    protein fragment
  • Active form
    Yes, after activation (pH adjusting)
  • Tag
    untagged
  • Contents
    500 mM NaCl, 25 mM Tris-HCl, pH 8.0
  • Protein purity
    >95%
  • Molecular weight
    24 kDa
  • UniProt number
    P43235
  • Gene number
    1513
  • Abbreviation
    CTSK
  • Full name
    cathepsin K
  • Other desciption
    Recombinant human procathepsin K of amino acids Glu19 - Met215 is expressed in E. coli with an additional M-residue at the N-terminus.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CTSK
  • Short name
    Procathepsin K (CTSK) (Recombinant Protein)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Homo sapiens
  • Alternative name
    Procathepsin K (cathepsin K) (Rec. Protein)
  • Alternative technique
    rec
  • Alternative to gene target
    cathepsin K, CTS02 and CTSO and CTSO1 and CTSO2 and PKND and PYCD, CTSK and IDBG-102192 and ENSG00000143387 and 1513, proteoglycan binding, Extracellular, Ctsk and IDBG-172787 and ENSMUSG00000028111 and 13038, CTSK and IDBG-633328 and ENSBTAG00000021035 and 513038
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee