Thrombin Receptor Antibody

  • Catalog number
    RP1092
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Thrombin Receptor
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Thrombin Receptor Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Thrombin Receptor Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model. 
  • Related articles
    1. Bahou, W. F., Nierman, W. C., Durkin, A. S., Potter, C. L., Demetrick, D. J. Chromosomal assignment of the human thrombin receptor gene: localization to region q13 of chromosome 5. Blood 82: 1532-1537, 1993.  2. Boire, A., Covic, L., Agarwal, A., Jacques, S., Sherifi, S., Kuliopulos, A. PAR1 is a matrix metalloprotease-1 receptor that promotes invasion and tumorigenesis of breast cancer cells. Cell 120: 303-131, 2005.  3. Coughlin, S. R., Vu, T.-K. H., Hung, D. T., Wheaton, V. I. Characterization of a functional thrombin receptor: issues and opportunities. J. Clin. Invest. 89: 351-355, 1992.
  • Gene Name
    F2R
  • Protein Name
    Proteinase-activated receptor 1
  • Gene Full Name
    coagulation factor II (thrombin) receptor
  • Synonyms
    CF2R antibody|Coagulation factor II (thrombin) receptor antibody|Coagulation factor II receptor antibody|F2R antibody|HTR antibody|PAR 1 antibody|PAR-1 antibody|PAR1 antibody|PAR1_HUMAN antibody|Protease activated receptor 1 antibody|Proteinase activated receptor 1 antibody|Proteinase-activated receptor 1 antibody|Thrombin receptor antibody|TR antibody
  • Uniprot ID
    P25116
  • Entrez GeneID
    2149
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    F2RL3, F2R, F2RL2
  • Short name
    Thrombin Receptor Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Thrombin Receptor (antibody to-)
  • Alternative technique
    antibodies
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee