RPA70 Antibody

  • Catalog number
    PB9886
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    RPA70
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the RPA70 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The RPA70 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex. RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits.
  • Related articles
    1. Erdile, L. F., Heyer, W.-D., Kolodner, R., Kelly, T. J. Characterization of a cDNA encoding the 70-kDa single-stranded DNA-binding subunit of human replication protein A and the role of the protein in DNA replication. J. Biol. Chem. 266: 12090-12098, 1991. Note: Erratum: J. Biol. Chem. 268: 2268 only, 1993. 2. Haring, S. J., Mason, A. C., Binz, S. K., Wold, M. S. Cellular functions of human RPA1: multiple roles of domains in replication, repair, and checkpoints. J. Biol. Chem. 283: 19095-19111, 2008.
  • Gene Name
    RPA1
  • Protein Name
    Replication protein A 70 kDa DNA-binding subunit
  • Gene Full Name
    replication protein A1
  • Synonyms
    Dmrpa1 antibody|Drosophila Replication Protein A antibody|DRPA antibody|HSSB antibody|Human single stranded DNA binding protein antibody|MST075 antibody|MSTP075 antibody|p70 antibody|REPA1 antibody|Replication factor A antibody|Replication factor A protein 1 antibody|Replication protein A 70 kDa DNA-binding subunit antibody|Replication protein A 70kDa DNA binding subunit antibody| Replication protein A1 70kDa antibody|Replication protein A1 antibody|RF A antibody|RF-A protein 1 antibody|RFA antibody|RFA1_HUMAN antibody|RP A antibody|RP-A p70 antibody|RPA 70 antibody|RPA antibody|rpa1 antibody|Single stranded binding protein 70 antibody| Single-stranded DNA-binding protein antibody
  • Uniprot ID
    P27694
  • Entrez GeneID
    6117
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    RPA70  
  • Gene symbol
    RPA1
  • Short name
    RPA70 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    RPA70 (antibody to-)
  • Alternative technique
    antibodies
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee