POR Antibody

• Catalog number
  PB9736
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  POR
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the POR Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The POR Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
• Related articles
  1. Adachi, M., Asakura, Y., Matsuo, M., Yamamoto, T., Hanaki, K., Arlt, W. POR R457H is a global founder mutation causing Antley-Bixler syndrome with autosomal recessive trait. (Letter) Am. J. Med. Genet. 140A: 633-635, 2006. 2. Miller, W. L. Congenital adrenal hyperplasia. (Letter) New Eng. J. Med. 314: 1321-1322, 1986. 3. Shephard, E. A., Phillips, I. R., Santisteban, I., West, L. F., Palmer, C. N., Ashworth, A., Povey, S. Isolation of a human cytochrome P-450 reductase cDNA clone and localization of the corresponding gene to chromosome 7q11.2. Ann. Hum. Genet. 53: 291-301, 1989.
• Gene Name
  POR
• Protein Name
  NADPH--cytochrome P450 reductase
• Gene Full Name
  P450 (cytochrome) oxidoreductase
• Synonyms
  CPR antibody|CYPOR antibody|DKFZp686G04235 antibody|FLJ26468 antibody|NADPH Cytochrome P450 Reductase antibody|NADPH dependent cytochrome P450 reductase antibody|NADPH--cytochrome P450 reductase antibody|NCPR_HUMAN antibody|P450 (cytochrome) oxidoreductase antibody|P450 Cytochrome Oxidoreductase antibody|P450R antibody|POR antibody
• Uniprot ID
  P16435
• Entrez GeneID
  5447
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  POR  
• Gene symbol
  POR, PORCN
• Short name
  POR Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  POR (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:9208
• Gene
  POR
• Long gene name
  cytochrome p450 oxidoreductase
• Synonyms gene name
  • P450 (cytochrome) oxidoreductase
• Synonyms
  • CYPOR
  • FLJ26468
• Synonyms name
  • NADPH--hemoprotein reductase
• GenBank acession
  • AF258341
• Locus
  7q11.23
• Discovery year
  1989-06-30
• Entrez gene record
  5447
• Pubmed identfication
  • 2516426
• RefSeq identity
  • NM_000941
• Classification
  • Small nucleolar RNA protein coding host genes
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000130413
• Locus Specific Databases
  • PharmVar Pharmacogene Variation Consortium

Gene info

• Identity
  HGNC:17652
• Gene
  PORCN
• Long gene name
  porcupine O-acyltransferase
• Synonyms gene
  • DHOF
• Synonyms gene name
  • dermal hypoplasia, focal
  • porcupine homolog (Drosophila)
• Synonyms
  • MG61
  • PORC
  • PPN
  • por
• GenBank acession
  • AF317058
• Locus
  Xp11.23
• Discovery year
  2004-05-12
• Entrez gene record
  64840
• Pubmed identfication
  • 10866835
  • 12034504
  • 17546030
  • 24798332
• RefSeq identity
  • NM_022825
• Classification
  • Membrane bound O-acyltransferases
• VEGA ID
  OTTHUMG00000024116

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products