-
Target antigen
Kininogen 1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Kininogen 1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Kininogen 1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins – high – molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.
-
Related articles
1. "Entrez Gene: kininogen 1". 2. Fong, D., Smith, D. I., Hsieh, W.-T. The human kininogen gene (KNG) mapped to chromosome 3q26-qter by analysis of somatic cell hybrids using the polymerase chain reaction. Hum. Genet. 87: 189-192, 1991.
-
Gene Name
KNG1
-
Protein Name
Kininogen-1
-
Gene Full Name
kininogen 1
-
Synonyms
Alpha-2-thiol proteinase inhibitor antibody|BDK antibody|BK antibody|Bradykinin antibody|Fitzgerald factor antibody|High molecular weight kininogen antibody|HMWK antibody|Ile-Ser-Bradykinin antibody|Kallidin I antibody|Kallidin II antibody|Kininogen antibody|KNG antibody|KNG1 antibody|KNG1_HUMAN antibody|Low molecular weight growth-promoting factor antibody|Williams-Fitzgerald-Flaujeac factor antibody
-
Uniprot ID
O08677
-
Entrez GeneID
16644
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
