-
Target antigen
Gremlin 1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Gremlin 1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Gremlin 1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
-
Related articles
1. Gazzero E, Pereira RC, Jorgetti V, Olson S, Economides AN, Canalis E (2005). "Skeletal overexpression of gremlin impairs bone formation and causes osteopenia". Endocrinology 142(2):655-665. 2. Namkoong H, Shin SM, Kim HK, Ha S, Cho GW, Hur SY, Kim TE, Kim JW (2006). "The bone morphognentic protein antagonist gremlin 1 is overespressed in human cancers and interacts with YWAHAH protein". BMC cancer 6:74. 3. Stabile H, Mitola S, Moroni E, Belleri M, Nicoli S, Coltrini D, Peri F, Pessi A, Orsatti L, Talamo F (2007). Blood 109(5):1834-1840.
-
Gene Name
GREM1
-
Protein Name
Gremlin-1
-
Gene Full Name
gremlin 1
-
Synonyms
BMP antagonist 1 antibody|Cell proliferation inducing gene 2 protein antibody|Cell proliferation-inducing gene 2 protein antibody| CKTSF1B1 antibody|Cysteine knot superfamily 1 antibody|Cysteine knot superfamily 1, BMP antagonist 1 antibody|Cysteine knot superfamily BMP antagonist 1 antibody|DAN domain family member 2 antibody|DAND2 antibody|Down regulated in Mos-transformed cells protein antibody|Down-regulated in Mos-transformed cells protein antibody|DRM antibody|grem1 antibody|GREM1_HUMAN antibody|Gremlin 1 like protein antibody| Gremlin 1, cysteine knot superfamily, homolog antibody|GREMLIN antibody|Gremlin-1 antibody| Gremlin1 antibody| IHG-2 antibody|IHG2 antibody|Increased in high glucose 2 antibody| Increased in high glucose protein 2 antibody|PIG2 antibody| Proliferation inducing gene 2 antibody|proliferation inducing gene 2 protein antibody
-
Uniprot ID
O60565
-
Entrez GeneID
26585
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
