Gremlin 1 Antibody

• Catalog number
  R31825
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  Gremlin 1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.
• Intented use
  This Gremlin 1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O60565
• Purity
  Antigen affinity
• Description
  Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
• Immunogen
  Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.
• Storage
  After reconstitution, the Gremlin 1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Gremlin  
• Gene symbol
  GREM1
• Short name
  Anti-Gremlin 1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to Gremlin 1
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:2001
• Gene
  GREM1
• Long gene name
  gremlin 1, DAN family BMP antagonist
• Synonyms gene
  • CKTSF1B1
  • CRAC1
• Synonyms gene name
  • cysteine knot superfamily 1, BMP antagonist 1
  • gremlin 1, cysteine knot superfamily, homolog (Xenopus laevis)
  • gremlin 1
  • colorectal adenoma and carcinoma 1
• Synonyms
  • DRM
  • gremlin
  • DAND2
  • HMPS
• Synonyms name
  • hereditary mixed polyposis syndrome
  • down-regulated in mos-transformed cells
• Locus
  15q13.3
• Discovery year
  1999-12-02
• Entrez gene record
  26585
• Pubmed identfication
  • 9660951
  • 10026205
  • 22561515
  • 27385727
• RefSeq identity
  • NM_013372
• Classification
  • DAN family
• VEGA ID
  OTTHUMG00000129319
• Locus Specific Databases
  • LRG_1365

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products