EIF3S4 antibody

• Catalog number
  70R-1402
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  DNA & RNA
• Type of Immunogen
  EIF3S4 antibodies were raised using the N terminal of EIF3S4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
• Raised in
  Rabbit
• Specificity
  EIF3S4 antibody was raised against the N terminal of EIF3S4
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EIF3S4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• Usage Recommendations
  WB: 1.25 ug/ml; IHC: 4-8 ug/ml
• Assay Information
  EIF3S4 Blocking Peptide, catalog no. 33R-8672, is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody
• Additional Information
  This is a rabbit polyclonal antibody against EIF3S4. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  EIF3S4  
• Gene symbol
  EIF3G
• Short name
  EIF3S4 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal EIF3S4 antibody raised against the N terminal of EIF3S4
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3274
• Gene
  EIF3G
• Long gene name
  eukaryotic translation initiation factor 3 subunit G
• Synonyms gene
  • EIF3S4
• Synonyms gene name
  • eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa
  • eukaryotic translation initiation factor 3, subunit G
• Synonyms
  • eIF3-delta
  • eIF3-p44
• GenBank acession
  • U96074
• Locus
  19p13.2
• Discovery year
  1998-11-26
• Entrez gene record
  8666
• Pubmed identfication
  • 9822659
• Classification
  • RNA binding motif containing
  • Eukaryotic translation initiation factor 3
• VEGA ID
  OTTHUMG00000180396

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products