-
Target antigen
CCR1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse CCR1 (260-290aa FVSAFQDVLFTNQCEQSKQLDLAMQVTEVIA), different from the related human sequence by nine amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the CCR1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The CCR1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
C-C chemokine receptor type 1 is a protein that in humans is encoded by the CCR1 gene. This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite.
-
Related articles
1. "Entrez Gene: CCR1 chemokine (C-C motif) receptor 1". 2. Neote K, DiGregorio D, Mak JY, Horuk R, Schall TJ (Mar 1993). "Molecular cloning, functional expression, and signaling characteristics of a C-C chemokine receptor". Cell 72 (3): 415–25.
-
Gene Name
CCR1
-
Protein Name
C-C chemokine receptor type 1
-
Gene Full Name
C-C motif chemokine receptor 1
-
Synonyms
C C CKR 1 | C-C CKR-1 | CC CKR 1 | CC-CKR-1 | CCR1 | CCR-1 | CCR 1 | CD191 | CD 191 | CKR 1 | CKR1 | CMKBR 1 | CMKBR1 | CMKR1 | CMKR 1 | HM145 | LD78 receptor | Mip 1a R | MIP 1alpha R | MIP-1alpha-R | MIP1aR | RANTES R | RANTES receptor | RANTES-R | SCYAR1 | P51675
-
Uniprot ID
P51675
-
Entrez GeneID
12768
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
