CCR1 Antibody
-
Catalog numberR32476
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenCCR1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityMouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
-
Added bufferLyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
-
Intented useThis CCR1 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP51675
-
PurityAntigen affinity
-
DescriptionC-C chemokine receptor type 1 is a protein that in humans is encoded by the CCR1 gene. This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite.
-
ImmunogenAmino acids FVSAFQDVLFTNQCEQSKQLDLAMQVTEVIA from the mouse protein were used as the immunogen for the CCR1 antibody.
-
StoragePrior to reconstitution, store at 4oC. After reconstitution, the CCR1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationCytoplasmic, membranous
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolCCR1
-
Short nameAnti- CCR1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to CCR1
-
Alternative techniqueantibodies
-
Alternative to gene targetchemokine (C-C motif) receptor 1, CD191 and CKR-1 and CKR1 and CMKBR1 and HM145 and MIP1aR and SCYAR1, CCR1 and IDBG-30085 and ENSG00000163823 and 1230, chemokine (C-C motif) ligand 5 binding, Cell surfaces
-
Gene info
-
Identity
-
Gene
-
Long gene nameC-C motif chemokine receptor 1
-
Synonyms gene
-
Synonyms gene name
- chemokine (C-C motif) receptor 1
-
Synonyms
-
Locus
-
Discovery year1993-10-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- C-C motif chemokine receptors
- CD molecules
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data