-
Target antigen
APRIL
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,ELISA
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the APRIL Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The APRIL Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
A proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
-
Related articles
1. "Entrez Gene: TNFSF13 tumor necrosis factor (ligand) superfamily, member 13". 2. Hahne M, Kataoka T, Schröter M, Hofmann K, Irmler M, Bodmer JL et al. (Sep 1998). "APRIL, a new ligand of the tumor necrosis factor family, stimulates tumor cell growth". The Journal of Experimental Medicine 188 (6): 1185–90.
-
Gene Name
TNFSF13
-
Protein Name
Tumor necrosis factor ligand superfamily member 13
-
Gene Full Name
tumor necrosis factor (ligand) superfamily, member 13
-
Synonyms
A proliferation inducing ligand antibody|A proliferation-inducing ligand antibody|APRIL antibody|CD 256 antibody|CD256 antibody|CD256 antigen antibody|Ligand antibody|PRO715 antibody|Proliferation inducing ligand APRIL antibody|TALL 2 antibody|TALL-2 antibody|TALL2 antibody|TNF and APOL related leukocyte expressed ligand 2 antibody|TNF related death ligand 1 antibody|TNF related death ligand antibody|TNF- and APOL-related leukocyte expressed ligand 2 antibody|TNF-related death ligand 1 antibody|TNF13_HUMAN antibody|TNFSF 13 antibody|TNFSF13 antibody|TNFSF13 protein antibody|TRDL 1 antibody|TRDL-1 antibody|TRDL1 antibody|Tumor necrosis factor (ligand) superfamily member 13 antibody|Tumor necrosis factor (ligand) superfamily, member 13 antibody|Tumor necrosis factor ligand superfamily member 13 antibody|Tumor necrosis factor like protein ZTNF2 antibody|Tumor necrosis factor related death ligand antibody|Tumor necrosis factor related death ligand 1 antibody|Tumor necrosis factor superfamily member 13 antibody|TWE PRIL antibody|UNQ383 antibody| UNQ383/ PRO715 antibody|ZTNF 2 antibody|ZTNF2 antibody
-
Uniprot ID
O75888
-
Entrez GeneID
8741
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
