Annexin VIII Antibody

  • Catalog number
    A08645
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Annexin VIII
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Annexin VIII Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Annexin VIII Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
  • Related articles
    1. Chambers, J. A., Gardner, E., Hauptmann, R., Ponder, B. A., Mulligan, L. M. TaqI polymorphisms at the annexin VIII locus (ANX8). Hum. Molec. Genet. 1: 550 only, 1992. 2. Chang, K.-S., Wang, G., Freireich, E. J., Daly, M., Naylor, S. L., Trujillo, J. M., Stass, S. A. Specific expression of the annexin VIIIgene in acute promyelocytic leukemia. Blood 79: 1802-1810, 1992. 3. Sarkar, A., Yang, P., Fan, Y.-H., Mu, Z. M., Hauptmann, R., Adolf, G. R., Stass, S. A., Chang, K.-S. Regulation of the expression ofannexin VIII in acute promyelocytic leukemia. Blood 84: 279-286, 1994.
  • Gene Name
    ANXA8
  • Protein Name
    Annexin A8
  • Gene Full Name
    annexin A8
  • Synonyms
    Annexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII
  • Uniprot ID
    P13928
  • Entrez GeneID
    653145
  • Description
    This Annexin V calcium dependent phospholipid binding protein will be downstream of BCL2 pathway and at caspase apoptotic level. boster has more cell death kits and antibodies.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    Annexin   VIII  
  • Gene symbol
    COX8A, G3BP1, MARCHF8
  • Short name
    Annexin VIII Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Annexin VIII (antibody to-)
  • Alternative technique
    antibodies
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee