Annexin VIII Antibody
-
Catalog numberA08645
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenAnnexin VIII
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the Annexin VIII Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe Annexin VIII Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
-
Related articles1. Chambers, J. A., Gardner, E., Hauptmann, R., Ponder, B. A., Mulligan, L. M. TaqI polymorphisms at the annexin VIII locus (ANX8). Hum. Molec. Genet. 1: 550 only, 1992. 2. Chang, K.-S., Wang, G., Freireich, E. J., Daly, M., Naylor, S. L., Trujillo, J. M., Stass, S. A. Specific expression of the annexin VIIIgene in acute promyelocytic leukemia. Blood 79: 1802-1810, 1992. 3. Sarkar, A., Yang, P., Fan, Y.-H., Mu, Z. M., Hauptmann, R., Adolf, G. R., Stass, S. A., Chang, K.-S. Regulation of the expression ofannexin VIII in acute promyelocytic leukemia. Blood 84: 279-286, 1994.
-
Gene NameANXA8
-
Protein NameAnnexin A8
-
Gene Full Nameannexin A8
-
SynonymsAnnexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII
-
Uniprot IDP13928
-
Entrez GeneID653145
-
DescriptionThis Annexin V calcium dependent phospholipid binding protein will be downstream of BCL2 pathway and at caspase apoptotic level. boster has more cell death kits and antibodies.
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolCOX8A, G3BP1, MARCHF8
-
Short nameAnnexin VIII Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameAnnexin VIII (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namecytochrome c oxidase subunit 8A
-
Synonyms gene
-
Synonyms gene name
- cytochrome c oxidase subunit VIII
- cytochrome c oxidase subunit VIIIA (ubiquitous)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1989-06-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Mitochondrial complex IV: cytochrome c oxidase subunits
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameG3BP stress granule assembly factor 1
-
Synonyms gene name
- GTPase activating protein (SH3 domain) binding protein 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2006-10-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RNA binding motif containing
- Endoribonucleases
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namemembrane associated ring-CH-type finger 8
-
Synonyms gene
-
Synonyms gene name
- c-mir, cellular modulator of immune recognition
- membrane-associated ring finger (C3HC4) 8
- membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-11-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ring finger proteins
- Membrane associated ring-CH-type fingers
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data