RHBDF1 antibody

#
  • Catalog number
    70R-6632
  • Price:

    Please ask

    Ask for price
  • Size
    50 µg
# #
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cell Biology
  • Type of Immunogen
    RHBDF1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
  • Raised in
    Rabbit
  • Cross Reactivity
    Human,Mouse,Rat
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHBDF1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    RHBDF1 Blocking Peptide, catalog no. 33R-4310, is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against RHBDF1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
#
  • Gene target
    RHBDF1  
  • Gene symbol
    RHBDF1
  • Short name
    RHBDF1 antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Rabbit polyclonal RHBDF1 antibody
  • Alternative technique
    antibodies
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee