Rabbit THOC1 antibody
-
Catalog number70R-4764
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenTHOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES
-
SpecificityTHOC1 antibody was raised against the C terminal of THOC1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THOC1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTHOC1-DT, THOC1
-
Short nameRabbit THOC1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal THOC1 antibody raised against the C terminal of THOC1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetTHO complex 1, HPR1 and P84 and P84N5, THOC1 and IDBG-282 and ENSG00000079134 and 9984, protein binding, nuclei, Thoc1 and IDBG-128300 and ENSMUSG00000024287 and 225160, THOC1 and IDBG-644087 and ENSBTAG00000019215 and 100138748
-
Gene info
-
Identity
-
Gene
-
Long gene nameTHOC1 divergent transcript
-
Locus
-
Discovery year2020-10-21
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene nameTHO complex 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-12-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- THO complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data