Rabbit PRKACA antibody
#
-
Catalog number70R-4594
-
Price:
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenPRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV
-
SpecificityPRKACA antibody was raised against the N terminal of PRKACA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKACA antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPRKACA
-
Short nameRabbit PRKACA antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PRKACA antibody raised against the N terminal of PRKACA
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotein kinase, cAMP-dependent, catalytic, alpha, PKACA, PRKACA and IDBG-32929 and ENSG00000072062 and 5566, transferase activity, nuclei, Prkaca and IDBG-173105 and ENSMUSG00000005469 and 18747, PRKACA and IDBG-642723 and ENSBTAG00000006642 and 282322
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotein kinase cAMP-activated catalytic subunit alpha
-
Synonyms gene name
- protein kinase, cAMP-dependent, catalytic, alpha
- protein kinase, cAMP-dependent, alpha catalytic subunit
-
Synonyms
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- AGC family kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data