Rabbit PIGF antibody
-
Catalog number70R-7111
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenPIGF antibody was raised using the N terminal of PIGF corresponding to a region with amino acids MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
-
SpecificityPIGF antibody was raised against the N terminal of PIGF
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGF antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPIGF, PGF
-
Short nameRabbit PIGF antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PIGF antibody raised against the N terminal of PIGF
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene namephosphatidylinositol glycan anchor biosynthesis class F
-
Synonyms gene name
- phosphatidylinositol glycan, class F
-
Locus
-
Discovery year1993-10-28
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Phosphatidylinositol glycan anchor biosynthesis
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameplacental growth factor
-
Synonyms gene
-
Synonyms gene name
- placental growth factor-like
- placental growth factor, vascular endothelial growth factor-related protein
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-01-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- VEGF family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data