Rabbit NET1 antibody

  • Catalog number
    70R-3139
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Neuroscience
  • Immunogen
    NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR
  • Specificity
    NET1 antibody was raised against the N terminal of NET1
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NET1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    NET1  
  • Gene symbol
    NET1, SLC6A5, PRPF38B, SLC6A2
  • Short name
    Rabbit NET1 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal NET1 antibody raised against the N terminal of NET1
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    neuroepithelial cell transforming 1, ARHGEF8 and NET1A, NET1 and IDBG-48898 and ENSG00000173848 and 10276, GTP-Rho binding, nuclei, Net1 and IDBG-128472 and ENSMUSG00000021215 and 56349, NET1 and IDBG-639242 and ENSBTAG00000007648 and 507365
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    solute carrier family 6 member 2
  • Synonyms gene
  • Synonyms gene name
    • solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2
    • solute carrier family 6 (neurotransmitter transporter), member 2
  • Synonyms
  • Synonyms name
  • Locus
  • Discovery year
    1994-03-16
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Solute carriers
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee