Rabbit MYD88 antibody

• Catalog number
  70R-5825
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYD88 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  MYD88  
• Gene symbol
  MYD88
• Short name
  Rabbit MYD88 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal MYD88 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  myeloid differentiation primary response 88, MYD88D, MYD88 and IDBG-25713 and ENSG00000172936 and 4615, TIR domain binding, Plasma membranes, Myd88 and IDBG-204565 and ENSMUSG00000032508 and 17874, MYD88 and IDBG-644299 and ENSBTAG00000000563 and 444881

Gene info

• Identity
  HGNC:7562
• Gene
  MYD88
• Long gene name
  MYD88 innate immune signal transduction adaptor
• Synonyms gene name
  • myeloid differentiation primary response gene (88)
  • myeloid differentiation primary response 88
• GenBank acession
  • U84408
• Locus
  3p22.2
• Discovery year
  1997-12-23
• Entrez gene record
  4615
• Pubmed identfication
  • 9013863
• RefSeq identity
  • NM_002468
• Classification
  • TIR domain containing
  • My-T-BRC complex
• VEGA ID
  OTTHUMG00000131083
• Locus Specific Databases
  • LRG_157

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products