Rabbit IL18RAP antibody
-
Catalog number70R-1665
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIL18RAP antibody was raised using the N terminal of IL18RAP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
-
SpecificityIL18RAP antibody was raised against the N terminal of IL18RAP
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IL18RAP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIL18RAP
-
Short nameRabbit IL18RAP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IL18RAP antibody raised against the N terminal of IL18RAP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterleukin 18 receptor accessory protein, ACPL and CD218b and CDw218b and IL-18R-beta and IL-18RAcP and IL-18Rbeta and IL-1R-7 and IL-1R7 and IL-1RAcPL and IL18RB, IL18RAP and IDBG-64252 and ENSG00000115607 and 8807, protein binding, Plasma membranes, Il18rap and IDBG-148672 and ENSMUSG00000026068 and 16174, IL18RAP and IDBG-630876 and ENSBTAG00000033748 and 493716
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin 18 receptor accessory protein
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Interleukin receptors
- MicroRNA protein coding host genes
- Immunoglobulin like domain containing
- TIR domain containing
- CD molecules
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data