Rabbit IL18RAP antibody

• Catalog number
  70R-1665
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cytokines & Growth Factors
• Immunogen
  IL18RAP antibody was raised using the N terminal of IL18RAP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
• Specificity
  IL18RAP antibody was raised against the N terminal of IL18RAP
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IL18RAP antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  IL18RAP  
• Gene symbol
  IL18RAP
• Short name
  Rabbit IL18RAP antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal IL18RAP antibody raised against the N terminal of IL18RAP
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  interleukin 18 receptor accessory protein, ACPL and CD218b and CDw218b and IL-18R-beta and IL-18RAcP and IL-18Rbeta and IL-1R-7 and IL-1R7 and IL-1RAcPL and IL18RB, IL18RAP and IDBG-64252 and ENSG00000115607 and 8807, protein binding, Plasma membranes, Il18rap and IDBG-148672 and ENSMUSG00000026068 and 16174, IL18RAP and IDBG-630876 and ENSBTAG00000033748 and 493716

Gene info

• Identity
  HGNC:5989
• Gene
  IL18RAP
• Long gene name
  interleukin 18 receptor accessory protein
• Synonyms
  • AcPL
  • CD218b
• GenBank acession
  • AF077346
• Locus
  2q12.1
• Discovery year
  1998-12-17
• Entrez gene record
  8807
• Pubmed identfication
  • 9792649
• RefSeq identity
  • NM_003853
• Classification
  • Interleukin receptors
  • MicroRNA protein coding host genes
  • Immunoglobulin like domain containing
  • TIR domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000130777

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products