Rabbit IL13RA2 antibody
-
Catalog number70R-7514
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIL13RA2 antibody was raised using the middle region of IL13RA2 corresponding to a region with amino acids GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
-
SpecificityIL13RA2 antibody was raised against the middle region of IL13RA2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL13RA2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIL13RA2
-
Short nameRabbit IL13RA2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IL13RA2 antibody raised against the middle region of IL13RA2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterleukin 13 receptor, alpha 2, CD213A2 and CT19 and IL-13R and IL13BP, IL13RA2 and IDBG-82958 and ENSG00000123496 and 3598, protein binding, Extracellular, Il13ra2 and IDBG-177428 and ENSMUSG00000031289 and 16165, IL13RA2 and IDBG-631325 and ENSBTAG00000020022 and 616008
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin 13 receptor subunit alpha 2
-
Synonyms gene name
- interleukin 13 receptor, alpha 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-03-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Interleukin receptors
- CD molecules
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data