Rabbit HAMP antibody
-
Catalog number70R-6236
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNutrition & Metabolism
-
ImmunogenHAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
-
SpecificityHAMP antibody was raised against the N terminal of HAMP
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAMP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHAMP
-
Short nameRabbit HAMP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HAMP antibody raised against the N terminal of HAMP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targethepcidin antimicrobial peptide, HAMP and IDBG-43921 and ENSG00000105697 and 57817, hormone activity, Extracellular, HAMP and IDBG-635586 and ENSBTAG00000017042 and 512301
-
Gene info
-
Identity
-
Gene
-
Long gene namehepcidin antimicrobial peptide
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-05-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data