Rabbit GRK5 antibody
-
Catalog number70R-5734
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenGRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
-
SpecificityGRK5 antibody was raised against the middle region of GRK5
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRK5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGRK5-IT1, GRK5
-
Short nameRabbit GRK5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GRK5 antibody raised against the middle region of GRK5
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetG protein-coupled receptor kinase 5, GPRK5, GRK5 and IDBG-91131 and ENSG00000198873 and 2869, transferase activity, nuclei, Grk5 and IDBG-181926 and ENSMUSG00000003228 and 14773, GRK5 and IDBG-640359 and ENSBTAG00000007981 and 281801
-
Gene info
-
Identity
-
Gene
-
Long gene nameGRK5 intronic transcript 1
-
Synonyms gene name
- GRK5 intronic transcript 1 (non-protein coding)
-
Locus
-
Discovery year2013-12-20
-
Entrez gene record
-
RefSeq identity
-
Classification
- Intronic transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameG protein-coupled receptor kinase 5
-
Synonyms gene
-
GenBank acession
-
Locus
-
Discovery year1994-03-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- AGC family kinases
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data