Rabbit GJA1 antibody

• Catalog number
  70R-6087
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cardiac Markers
• Immunogen
  GJA1 antibody was raised using the middle region of GJA1 corresponding to a region with amino acids GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS
• Specificity
  GJA1 antibody was raised against the middle region of GJA1
• Cross Reactivity
  Human,Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJA1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  GJA1  
• Gene symbol
  GJA1
• Short name
  Rabbit GJA1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal GJA1 antibody raised against the middle region of GJA1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  gap junction protein, alpha 1, 43kDa, AVSD3 and CMDR and CX43 and GJAL and HLHS1 and HSS and ODDD, GJA1 and IDBG-95984 and ENSG00000152661 and 2697, scaffold protein binding, Cell surfaces, Gja6 and IDBG-183213 and ENSMUSG00000055691 and 414089, GJA1 and IDBG-630590 and ENSBTAG00000001835 and 281193

Gene info

• Identity
  HGNC:4274
• Gene
  GJA1
• Long gene name
  gap junction protein alpha 1
• Synonyms gene
  • ODDD
  • GJAL
• Synonyms gene name
  • gap junction protein, alpha-like
  • gap junction protein, alpha 1, 43kDa (connexin 43)
  • gap junction protein, alpha 1, 43kDa
• Synonyms
  • CX43
  • ODD
  • ODOD
  • SDTY3
• Synonyms name
  • oculodentodigital dysplasia (syndactyly type III)
  • connexin 43
• GenBank acession
  • BC026329
• Locus
  6q22.31
• Discovery year
  1990-08-03
• Entrez gene record
  2697
• Pubmed identfication
  • 10331943
  • 1646158
• RefSeq identity
  • NM_000165
• Classification
  • Gap junction proteins
• VEGA ID
  OTTHUMG00000015479
• Locus Specific Databases
  • Hereditary Hearing Loss Homepage
  • LRG_1289

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products