Rabbit CDH16 antibody
-
Catalog number70R-6155
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD
-
SpecificityCDH16 antibody was raised against the N terminal of CDH16
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH16 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCDH16
-
Short nameRabbit CDH16 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CDH16 antibody raised against the N terminal of CDH16
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcadherin 16, KSP-cadherin, CDH16 and IDBG-35695 and ENSG00000166589 and 1014, calcium ion binding, Plasma membranes, Cdh16 and IDBG-185772 and ENSMUSG00000031881 and 12556, CDH16 and IDBG-633206 and ENSBTAG00000009585 and 508777
-
Gene info
-
Identity
-
Gene
-
Long gene namecadherin 16
-
Synonyms gene name
- cadherin 16, KSP-cadherin
-
GenBank acession
-
Locus
-
Discovery year1997-02-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- 7D cadherins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data