Rabbit BTG4 antibody

• Catalog number
  70R-5595
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Cycle & Cell Death
• Immunogen
  BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
• Specificity
  BTG4 antibody was raised against the middle region of BTG4
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTG4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  BTG4  
• Gene symbol
  BTG4
• Short name
  Rabbit BTG4 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal BTG4 antibody raised against the middle region of BTG4
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  B-cell translocation gene 4, BTG4 and IDBG-70797 and ENSG00000137707 and 54766, multiple, Btg4 and IDBG-164716 and ENSMUSG00000032056 and 56057, BTG4 and IDBG-630144 and ENSBTAG00000034346 and 519995

Gene info

• Identity
  HGNC:13862
• Gene
  BTG4
• Long gene name
  BTG anti-proliferation factor 4
• Synonyms gene name
  • B-cell translocation gene 4
  • BTG family member 4
• Synonyms
  • PC3B
  • APRO3
• GenBank acession
  • AJ271351
• Locus
  11q23.1
• Discovery year
  2000-11-15
• Entrez gene record
  54766
• Pubmed identfication
  • 10995567
• RefSeq identity
  • NM_017589
• Classification
  • BTG/Tob family
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000166718

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products