Rabbit BTG4 antibody
-
Catalog number70R-5595
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Cycle & Cell Death
-
ImmunogenBTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
-
SpecificityBTG4 antibody was raised against the middle region of BTG4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTG4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBTG4
-
Short nameRabbit BTG4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal BTG4 antibody raised against the middle region of BTG4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetB-cell translocation gene 4, BTG4 and IDBG-70797 and ENSG00000137707 and 54766, multiple, Btg4 and IDBG-164716 and ENSMUSG00000032056 and 56057, BTG4 and IDBG-630144 and ENSBTAG00000034346 and 519995
-
Gene info
-
Identity
-
Gene
-
Long gene nameBTG anti-proliferation factor 4
-
Synonyms gene name
- B-cell translocation gene 4
- BTG family member 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-11-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- BTG/Tob family
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data