Rabbit BDNF antibody
-
Catalog number70R-6209
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenBDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
-
SpecificityBDNF antibody was raised against the middle region of BDNF
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BDNF antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBDNF, BDNF-AS
-
Short nameRabbit BDNF antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal BDNF antibody raised against the middle region of BDNF
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetbrain-derived neurotrophic factor, ANON2 and BULN2, BDNF and IDBG-36817 and ENSG00000176697 and 627, growth factor activity, Extracellular, Bdnf and IDBG-195506 and ENSMUSG00000048482 and 12064, BDNF and IDBG-636102 and ENSBTAG00000008134 and 617701
-
Gene info
-
Identity
-
Gene
-
Long gene namebrain derived neurotrophic factor
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1991-01-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Neurotrophins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameBDNF antisense RNA
-
Synonyms gene
-
Synonyms gene name
- BDNF opposite strand (non-protein coding)
- BDNF antisense RNA (non-protein coding)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2005-02-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data