Rabbit ASGR1 antibody
-
Catalog number70R-2850
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
-
SpecificityASGR1 antibody was raised against the N terminal of ASGR1
-
Cross ReactivityHuman, Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASGR1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolASGR1
-
Short nameRabbit ASGR1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ASGR1 antibody raised against the N terminal of ASGR1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetasialoglycoprotein receptor 1, ASGPR and ASGPR1 and CLEC4H1 and HL-1, ASGR1 and IDBG-23366 and ENSG00000141505 and 432, metal ion binding, Extracellular, Asgr1 and IDBG-193435 and ENSMUSG00000020884 and 11889, ASGR1 and IDBG-634567 and ENSBTAG00000012071 and 509121
-
Gene info
-
Identity
-
Gene
-
Long gene nameasialoglycoprotein receptor 1
-
Synonyms
-
Locus
-
Discovery year1988-05-24
-
Entrez gene record
-
RefSeq identity
-
Classification
- C-type lectin domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data