Rabbit AKTIP antibody
-
Catalog number70R-2220
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenAKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
-
SpecificityAKTIP antibody was raised against the middle region of AKTIP
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKTIP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolAKTIP
-
Short nameRabbit AKTIP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal AKTIP antibody raised against the middle region of AKTIP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetAKT interacting protein, AKTIP and IDBG-31049 and ENSG00000166971 and 64400, acid-amino acid ligase activity, Plasma membranes, Aktip and IDBG-179747 and ENSMUSG00000031667 and 14339, AKTIP and IDBG-631788 and ENSBTAG00000016250 and 540462
-
Gene info
-
Identity
-
Gene
-
Long gene nameAKT interacting protein
-
Synonyms gene
-
Synonyms gene name
- fused toes homolog (mouse)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-10-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- FHF complex
- Ubiquitin conjugating enzymes E2
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data