Rabbit AHSG antibody

• Catalog number
  70R-5916
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  AHSG antibody was raised using the N terminal of AHSG corresponding to a region with amino acids AQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
• Specificity
  AHSG antibody was raised against the N terminal of AHSG
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHSG antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  AHSG  
• Gene symbol
  AHSG
• Short name
  Rabbit AHSG antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal AHSG antibody raised against the N terminal of AHSG
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  alpha-2-HS-glycoprotein, A2HS and AHS and FETUA and HSGA, AHSG and IDBG-68916 and ENSG00000145192 and 197, kinase inhibitor activity, Extracellular, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988

Gene info

• Identity
  HGNC:349
• Gene
  AHSG
• Long gene name
  alpha 2-HS glycoprotein
• Synonyms
  • FETUA
  • A2HS
  • HSGA
• Synonyms name
  • fetuin A
• GenBank acession
  • D67013
  • M16961
• Locus
  3q27.3
• Discovery year
  1986-01-01
• Entrez gene record
  197
• Pubmed identfication
  • 9322749
  • 7736783
• RefSeq identity
  • NM_001622
• Classification
  • Cystatins, type 4
• VEGA ID
  OTTHUMG00000156605

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products