Rabbit AGTR1 antibody
-
Catalog number70R-5938
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaHormones & Steroids
-
ImmunogenAGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI
-
SpecificityAGTR1 antibody was raised against the N terminal of AGTR1
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGTR1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolAGTR1
-
Short nameRabbit AGTR1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal AGTR1 antibody raised against the N terminal of AGTR1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetangiotensin II receptor, type 1, AG2S and AGTR1B and AT1 and AT1AR and AT1B and AT1BR and AT1R and AT2R1 and HAT1R, AGTR1 and IDBG-60289 and ENSG00000144891 and 185, protein heterodimerization activity, Plasma membranes, AGTR1 and IDBG-647315 and ENSBTAG00000045633 and 281607
-
Gene info
-
Identity
-
Gene
-
Long gene nameangiotensin II receptor type 1
-
Synonyms gene
-
Synonyms gene name
- angiotensin receptor 1B
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1992-08-25
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Angiotensin receptors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data