Rabbit AGPAT2 antibody
-
Catalog number70R-1770
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenAGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
-
SpecificityAGPAT2 antibody was raised against the C terminal of AGPAT2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AGPAT2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolAGPAT2
-
Short nameRabbit AGPAT2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal AGPAT2 antibody raised against the C terminal of AGPAT2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene target1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), 1-AGPAT2 and BSCL and BSCL1 and LPAAB and LPAAT-beta, AGPAT2 and IDBG-92546 and ENSG00000169692 and 10555, transferase activity, Plasma membranes, Agpat2 and IDBG-149798 and ENSMUSG00000026922 and 67512, BT.22590 and IDBG-640598 and ENSBTAG00000025161 and 512112
-
Gene info
-
Identity
-
Gene
-
Long gene name1-acylglycerol-3-phosphate O-acyltransferase 2
-
Synonyms gene
-
Synonyms gene name
- Berardinelli-Seip congenital lipodystrophy
- 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-12-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- 1-acylglycerol-3-phosphate O-acyltransferases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data